Peptides Nasal Sprays
-
- Nasal Spray, New Arrivals
- Aicar Nasal Spray
- £25.99 – £45.99
- Molecular Formula: C9H15N4O8P Molecular Weight: 338.21 g/mol Purity: 99% Sequence: 5-Aminoimidazole-4-carboxamide ribonucleotide 100mg in AICAR 25ml 50mg in AICAR 15ml
- Select options
-
- AOD, Nasal Spray, New Arrivals
- AOD-9604 Nasal Spray
- £19.99 – £33.99
- Sequence: Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser Cys Gly Phe-Tyr Molecular Formula: C78H123N23O23S2 Molecular Weight: 1817.116 25ml nasal spray contains 4mg AOD-9604 Peptide 15ml nasal spray contains 2mg AOD-9604 Peptide
- Select options
-
- BPC-157, Healing, Injury Recovery, Nasal Spray, New Arrivals, TB500
- BPC157 and TB500 Blend Nasal Spray
- £65.99 – £124.99
- TB500= 10mg | BPC157 Blend = 10mg 25ml nasal spray contains 20mg TB500 & BPC157 Blend Peptide 15ml nasal spray contains 10mg TB500 & BPC157 Blend Peptide
- Select options
-
- BPC-157, Nasal Spray
- BPC157 Nasal Spray
-
£17.99 – £27.99
Rated 4.00 out of 5
- Sequence: Gly- Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ma Asp-Asp Ala Gly Leu Val Molecular Formula: C62H98N16O22 Molecular Weight: 1419.556 15ml bottle contains = 2mg BPC – 157 Peptide 25ml bottle contains = 5mg BPC – 157 Peptide
- Select options
-
- CJC-1295 Dac, Nasal Spray, New Arrivals
- CJC-1295 DAC Vial Nasal Spray
- £29.99 – £53.99
- Sequence: Tyr 0 Ala Asp-Ala Ile-Phe-Thr Gln-Ser Tyr Arg-Lys Val Leu-Ala Gln Lou Ser-Ala Aro Lys Leu Leu Gln Asp-Ile-Leu-Ser-Arg Molecular Formula: C152 H252 N44 042 Molecular Weight:3357.954 25ml nasal spray contains 4mg CJC1295 DAC Peptide 15ml nasal spray contains 2mg CJC1295 DAC Peptide
- Select options
-
- CJC1296 NO-DAC, Nasal Spray
- CJC-1295 No DAC Nasal Spray
- £19.99 – £35.99
- Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg–NH2 Molecular Formula: C152H252N44O42 Molecular Weight: 3367.97 15ml has 2mg CJC-1295 No DAC Peptide 25ml has 5mg CJC-1295 No DAC Peptide
- Select options
-
- Nasal Spray
- DSIP Nasal Spray
- £25.99 – £45.99
- Sequence: Trp-Ala Gly Gly AspAla-Ser-Gly-Glu Molecular Formula: C35H48N10O15 Molecular Weight: 848.824 15ml containing 2mg DSIP 25ml containing 4mg DSIP
- Select options
-
- EPITHALON, Nasal Spray
- Epithalon Nasal Spray
- £22.99 – £39.99
- Molecular Formula: C14H22N4O9 Molecular Weight: 390.349 15ml has 10mg Epithalon Peptide 25ml has 20mg Epithalon Peptide
- Select options
-
- Nasal Spray
- FOXO4-DRI Nasal Sprays
- £209.99 – £409.99
- This Vial Contains 10mg Purity: >98% Molecular Formula: C228H388N86O64 Molecular Weight: 5358.05 g/mol Sequence: H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH
- Select options
-
- Nasal Spray
- GHK-Cu Nasal Spray
-
£25.99 – £45.99
Rated 4.00 out of 5
- Sequence: Gly-His-Lys Molecular Formula: C14 H24 N6 O4 Molecular Weight: 340.384 g/mol 25ml has 5mg GHK-Cu Peptide 15ml has 2mg GHK-Cu Peptide
- Select options
-
- Nasal Spray
- GHRP-2 Nasal Spray
- £25.99 – £59.99
- Sequence: H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 Molecular Formula: C12H35N56O78S Molecular Weight: 817.992 g/mol 15ml has 2mg GHRP-2 Peptide 25ml has 5mg GHRP-2 Peptide
- Select options
-
- CJC-1295 Dac, Nasal Spray, New Arrivals
- GHRP-6 and CJC-1295 DAC Blend Nasal Spray
- £39.99 – £79.99
- CJC-1295 = 0.6mg | GHRP-6 = 1.5mg GHRP-6 & CJC1295 Blend 25ml Contains 4mg GHRP-6 & CJC1295 Blend 15ml Contains 2mg
- Select options
-
- Nasal Spray, New Arrivals
- GHRP-6 Nasal Spray
- £19.99 – £29.99
- Sequence: H-His-D-Trp-Ala-Trp-D-Phe-Lys-NH2 Molecular Formula: C46H56N12O6 Molecular Weight: 873.032 g/mol 25ml nasal spray contains 10mg Peptide GHRP-6 15ml nasal spray contains 5mg Peptide GHRP-6
- Select options
-
- Nasal Spray, New Arrivals
- Gonadorelin Nasal Spray
- £14.99 – £24.99
- sequence: Pyr-Hls-Trp-Ser-Tyr Gly Leu Arg Pro Gly Molecular Formula: C55 H75 N17 O13 Molecular Weight: 1182.311 g/mol 25ml nasal spray contains 4mg Peptide Gonadorelin 15ml nasal spray contains 2mg Peptide Gonadorelin
- Select options
-
- Nasal Spray
- Hexarelin Nasal Spray
- £26.99 – £48.99
- Sequence: H-His-D-2-Me-Trp-Ala-Trp-D-Phe-Lys-NH2 Molecular Formula: C47H58N12O6 Molecular Weight: 887.04 15ml has 5mg Hexarelin Peptide 25ml has 2mg Hexarelin Peptide
- Select options
-
- Sale!
- CJC-1295 Dac, HGH FRAGMENT 176-191, Nasal Spray, New Arrivals
- HGH Fragment 176-191 & CJC-1295 DAC Blend Nasal Spray
- £41.99 – £71.99
- HGH Fragment 176-191 = 1.5mg CJC 1295 = 0.6mg Per 2mg Vial HGH Fragment & CJC 1295 25ml Contains 4mg HGH Fragment & CJC 1296 15ml Contains 2mg
- Select options
Quick Product Search
Direct Sarms Promotions {name}
1st time order discount
We offer 10% discount for all customers on first time orders.
When going through the checkout process please add the code ‘1storder’ and the 10% discount is applied.
Bulk Buy Discounts
Buy any three products and get 10% discount
FREE Delivery
Spend over £200.00 and get UK and International delivery free of charge.
Ongoing deals & Wholesale
If you are looking at purchasing a high quantity of research peptides Contact us for the best deal and look at our facebook page for daily offers and promotions.
Get 10% off your order by paying with Bitcoin securely and without fuss. Please note there is a 10 minute timelimit on the checkout.
IMPORTANT. PLEASE READ!
The products we offer are intended for IN LABORATORY USE ONLY and are NOT intended for use as food additives, drugs or household chemicals.
The products we offer ARE NOT FOR HUMAN OR ANIMAL CONSUMPTION, or to diagnose, treat or prevent any illness of disease.
By purchasing any product you acknowledge there are risks involved with their consumption.
Useful Articles
-
SNAP-8 – Botox In A BottleFebruary 15, 2021/0 Comments
-
TB500 – Benefits Of The Healing & Repairing Peptide {name}November 2, 2020/
-
SARMs Liquid vs CapsulesOctober 29, 2020/
-
Boost Your Immune System!October 9, 2019/
-
Melanotan 1 or Melanotan 2 – Which one?September 23, 2019/
-
Which is Safer Between MT-1 and MT-2 for Your Tanning Needs?September 20, 2019/
-
Direct Sarms Worldwide ServiceAugust 20, 2019/
-
Oxytocin Love Hormone OverviewJune 19, 2019/
-
SARMs And Weight LossJune 17, 2019/